Tropomyosin 2 (TPM2) Rabbit Polyclonal Antibody

CAT#: TA346576

Rabbit Polyclonal Anti-TPM2 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 4,537.00


货期*
2周

规格
    • 100 ug

Product images

经常一起买 (4)
Transient overexpression lysate of tropomyosin 2 (beta) (TPM2), transcript variant 1
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human tropomyosin 2 (beta) (TPM2), transcript variant 1, 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Recombinant protein of human tropomyosin 2 (beta) (TPM2), transcript variant 1, 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TPM2 antibody: synthetic peptide directed towards the C terminal of human TPM2. Synthetic peptide located within the following region: AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 33 kDa
Gene Name tropomyosin 2 (beta)
Background This gene encodes beta-tropomyosin, a member of the actin filament binding protein family, and mainly expressed in slow, type 1 muscle fibers. Mutations in this gene can alter the expression of other sarcomeric tropomyosin proteins, and cause cap disease, nemaline myopathy and distal arthrogryposis syndromes. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]
Synonyms AMCD1; DA1; DA2B; HEL-S-273; NEM4; TMSB
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 86%; Pig: 85%; Horse: 85%; Sheep: 85%; Guinea pig: 79%
Reference Data
Protein Pathways Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...