AKR1B1 Rabbit Polyclonal Antibody

CAT#: TA346555

Rabbit Polyclonal Anti-AKR1B1 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of aldo-keto reductase family 1, member B1 (aldose reductase) (AKR1B1)
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Purified recombinant protein of Homo sapiens aldo-keto reductase family 1, member B1 (aldose reductase) (AKR1B1), 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Purified recombinant protein of Homo sapiens aldo-keto reductase family 1, member B1 (aldose reductase) (AKR1B1), 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Mouse, Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the N terminal of human AKR1B1. Synthetic peptide located within the following region: ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 36 kDa
Gene Name aldo-keto reductase family 1, member B1 (aldose reductase)
Background This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. [provided by RefSeq, Feb 2009]
Synonyms ADR; ALDR1; ALR2; AR
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93%; Zebrafish: 91%; Dog: 86%; Yeast: 86%
Reference Data
Protein Families Druggable Genome
Protein Pathways Fructose and mannose metabolism, Galactose metabolism, Glycerolipid metabolism, Metabolic pathways, Pentose and glucuronate interconversions, Pyruvate metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...