SLC14A1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SLC14A1 antibody: synthetic peptide directed towards the C terminal of human SLC14A1. Synthetic peptide located within the following region: LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	solute carrier family 14 member 1 (Kidd blood group)
Database Link	NP_056949 Entrez Gene 6563 Human UniProt ID Q13336
Background	The protein encoded by this gene is a membrane transporter that mediates urea transport in erythrocytes. This gene forms the basis for the Kidd blood group system. [provided by RefSeq, Mar 2009]
Synonyms	HsT1341; HUT11; JK; RACH1; RACH2; UT-B1; UT1; UTE
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Goat: 93%; Sheep: 93%; Bovine: 86%; Horse: 83%; Mouse: 83%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.