RNASE9 Rabbit Polyclonal Antibody
CAT#: TA346522
Rabbit Polyclonal Anti-RNASE9 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RNASE9 antibody: synthetic peptide directed towards the N terminal of human RNASE9. Synthetic peptide located within the following region: PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 24 kDa |
Gene Name | ribonuclease A family member 9 (inactive) |
Database Link | |
Background | RNASE9 belongs to the pancreatic ribonuclease family. It may be involved in host defense. |
Synonyms | h461; HEL128; RAK1 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 86% |
Reference Data | |
Protein Families | Secreted Protein |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |