Saa1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Saa1 antibody is: synthetic peptide directed towards the middle region of Mouse Saa1. Synthetic peptide located within the following region: DKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	14 kDa
Gene Name	serum amyloid A 1
Database Link	NP_033143 Entrez Gene 20208 Mouse UniProt ID P05366
Background	Saa1 is a major acute phase reactant and apolipoprotein of the HDL complex.
Synonyms	MGC111216; PIG4; SAA; TP53I4
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Goat: 93%; Mouse: 93%; Bovine: 93%; Sheep: 92%; Guinea pig: 92%; Zebrafish: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.