MYH10 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MYH10 antibody: synthetic peptide directed towards the N terminal of human MYH10. Synthetic peptide located within the following region: WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	229 kDa
Gene Name	myosin, heavy chain 10, non-muscle
Database Link	NP_005955 Entrez Gene 4628 Human UniProt ID P35580
Background	MYH10 is the cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping.
Synonyms	NMMHC-IIB; NMMHCB
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Regulation of actin cytoskeleton, Tight junction, Viral myocarditis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.