CYP4A22 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: AQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQERVKTFPS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	cytochrome P450 family 4 subfamily A member 22
Database Link	NP_001010969 Entrez Gene 284541 Human UniProt ID Q5TCH4
Background	CYP4A22 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.
Synonyms	cytochrome P450; cytochrome P450 4A22; cytochrome P450 4A22K; family 4; OTTHUMP00000009560; polypeptide 22; subfamily A
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	P450, Transmembrane
Protein Pathways	Arachidonic acid metabolism, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway, Retinol metabolism, Vascular smooth muscle contraction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.