Prothrombin (F2) Rabbit Polyclonal Antibody

CAT#: TA346199

Rabbit Polyclonal Anti-F2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of coagulation factor II (thrombin) (F2)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human coagulation factor II (thrombin) (F2), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human coagulation factor II (thrombin) (F2), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Rat
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-F2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 70 kDa
Gene Name coagulation factor II, thrombin
Background F2 catalyzes the preferential cleavage of Arg-Gly; activates fibrinogen to fibrin and releases fibrinopeptides A and B; involved in blood coagulation and wound repair.
Synonyms PT; RPRGL2; THPH1
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Sheep: 93%; Pig: 92%; Rat: 86%; Rabbit: 86%; Guinea pig: 80%
Reference Data
Protein Families Druggable Genome, Protease, Secreted Protein
Protein Pathways Complement and coagulation cascades, Neuroactive ligand-receptor interaction, Regulation of actin cytoskeleton
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...