Cytokeratin 17 (KRT17) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KRT17 antibody: synthetic peptide directed towards the C terminal of human KRT17. Synthetic peptide located within the following region: IATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKVISSREQVHQT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	keratin 17
Database Link	NP_000413 Entrez Gene 3872 Human UniProt ID Q04695
Background	KRT17 is type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in its gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.KRT17 encodes the type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in this gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.
Synonyms	39.1; CK-17; K17; PC; PC2; PCHC1
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%; Zebrafish: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.