HMGCL Rabbit Polyclonal Antibody

CAT#: TA346165

Rabbit Polyclonal Anti-HMGCL Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,537.00


货期*
2周

规格
    • 100 ug

Product images

经常一起买 (4)
Transient overexpression lysate of 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase (HMGCL), nuclear gene encoding mitochondrial protein, transcript variant 1
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase (HMGCL), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase (HMGCL), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-HMGCL antibody: synthetic peptide directed towards the N terminal of human HMGCL. Synthetic peptide located within the following region: WVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 36 kDa
Gene Name 3-hydroxymethyl-3-methylglutaryl-CoA lyase
Background The deficiency of HMGCL is related to an autosomal recessive branched chain organic aciduria.
Synonyms HL
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 92%; Zebrafish: 91%
Reference Data
Protein Families Druggable Genome
Protein Pathways Butanoate metabolism, Metabolic pathways, Synthesis and degradation of ketone bodies, Valine, leucine and isoleucine degradation
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...