VSIG4 Rabbit Polyclonal Antibody

CAT#: TA346124

Rabbit Polyclonal Anti-VSIG4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 1
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human V-set and immunoglobulin domain containing 4 (VSIG4), transcript variant 1, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-VSIG4 antibody: synthetic peptide directed towards the N terminal of human VSIG4. Synthetic peptide located within the following region: VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 44 kDa
Gene Name V-set and immunoglobulin domain containing 4
Background T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production.
Synonyms CRIg; Z39IG
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 92%; Mouse: 92%; Guinea pig: 92%; Horse: 91%; Rat: 86%; Rabbit: 82%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...