VSIG4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-VSIG4 antibody: synthetic peptide directed towards the N terminal of human VSIG4. Synthetic peptide located within the following region: VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	V-set and immunoglobulin domain containing 4
Database Link	NP_009199 Entrez Gene 11326 Human UniProt ID Q9Y279
Background	T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production.
Synonyms	CRIg; Z39IG
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 92%; Mouse: 92%; Guinea pig: 92%; Horse: 91%; Rat: 86%; Rabbit: 82%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.