MASP2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Masp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	75 kDa
Gene Name	mannan binding lectin serine peptidase 2
Database Link	NP_006601 Entrez Gene 17175 MouseEntrez Gene 10747 Human UniProt ID O00187
Background	Masp2 is a serum protease that plays an important role in the activation of the complement system via mannose-binding lectin. After activation by auto-catalytic cleavage it cleaves C2 and C4, leading to their activation and to the formation of C3 convertase.
Synonyms	MAP19; MASP-2; MASP1P1; sMAP
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Rat: 92%; Guinea pig: 79%; Horse: 77%; Zebrafish: 77%
Reference Data
Protein Families	Druggable Genome, Protease, Secreted Protein
Protein Pathways	Complement and coagulation cascades

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.