FBP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FBP1 antibody: synthetic peptide directed towards the N terminal of human FBP1. Synthetic peptide located within the following region: YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	fructose-bisphosphatase 1
Database Link	NP_000498 Entrez Gene 2203 Human UniProt ID P09467
Background	Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.
Synonyms	FBP
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%; Bovine: 86%; Zebrafish: 80%
Reference Data
Protein Families	Druggable Genome, Stem cell - Pluripotency
Protein Pathways	Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Insulin signaling pathway, Metabolic pathways, Pentose phosphate pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.