FBP1 Rabbit Polyclonal Antibody

CAT#: TA346042

Rabbit Polyclonal Anti-FBP1 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of fructose-1,6-bisphosphatase 1 (FBP1), transcript variant 1
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human fructose-1,6-bisphosphatase 1 (FBP1), transcript variant 1, 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Recombinant protein of human fructose-1,6-bisphosphatase 1 (FBP1), transcript variant 1, 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-FBP1 antibody: synthetic peptide directed towards the N terminal of human FBP1. Synthetic peptide located within the following region: YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 37 kDa
Gene Name fructose-bisphosphatase 1
Background Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.
Synonyms FBP
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%; Bovine: 86%; Zebrafish: 80%
Reference Data
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Insulin signaling pathway, Metabolic pathways, Pentose phosphate pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...