Cyclophilin E (PPIE) Rabbit Polyclonal Antibody
CNY 4,537.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PPIE antibody: synthetic peptide directed towards the middle region of human PPIE. Synthetic peptide located within the following region: RIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 26 kDa |
Gene Name | peptidylprolyl isomerase E |
Database Link | |
Background | PPIE is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activityThe protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activity. Three alternatively spliced transcript variants encoding distinct isoforms have been observed. |
Synonyms | CYP-33; MGC3736; MGC111222 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Yeast: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | Spliceosome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它Cyclophilin E产品