RBM12 Rabbit Polyclonal Antibody

CAT#: TA345942

Rabbit Polyclonal Anti-RBM12 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Transient overexpression lysate of RNA binding motif protein 12 (RBM12), transcript variant 2
    • 100 ug

CN¥ 3,080.00


Transient overexpression lysate of RNA binding motif protein 12 (RBM12), transcript variant 1
    • 100 ug

CN¥ 4,840.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-RBM12 antibody: synthetic peptide directed towards the middle region of human RBM12. Synthetic peptide located within the following region: VLVDNNGQGLGQALVQFKNEDDARKSERLHRKKLNGREAFVHVVTLEDMR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 97 kDa
Gene Name RNA binding motif protein 12
Background RBM12 contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. The function of RBM12 remains unknown.This gene encodes a protein that contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. This gene and the gene for copine I overlap at map location 20q11.21. Alternative splicing in the 5' UTR results in two transcript variants. Both variants encode the same protein.
Synonyms HRIHFB2091; SWAN
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 85%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...