RBM12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RBM12 antibody: synthetic peptide directed towards the middle region of human RBM12. Synthetic peptide located within the following region: VLVDNNGQGLGQALVQFKNEDDARKSERLHRKKLNGREAFVHVVTLEDMR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	97 kDa
Gene Name	RNA binding motif protein 12
Database Link	NP_006038 Entrez Gene 10137 Human UniProt ID Q9NTZ6
Background	RBM12 contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. The function of RBM12 remains unknown.This gene encodes a protein that contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. This gene and the gene for copine I overlap at map location 20q11.21. Alternative splicing in the 5' UTR results in two transcript variants. Both variants encode the same protein.
Synonyms	HRIHFB2091; SWAN
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.