Ptbp3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Rod1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	polypyrimidine tract binding protein 3
Database Link	NP_659153 Entrez Gene 230257 Mouse UniProt ID Q8BHD7
Background	Rod1 may play a role in regulation of differentiation. In vitro, It binds RNA, preferentially to both poly(G) and poly(U)
Synonyms	5830471K22Rik; AA407443; AI462022; AW107884; C86549; Rod1
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Zebrafish: 93%; Dog: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.