PRKRA Rabbit Polyclonal Antibody

CAT#: TA345847

Rabbit Polyclonal Anti-PRKRA Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1, 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Recombinant protein of human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1, 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PRKRA antibody: synthetic peptide directed towards the middle region of human PRKRA. Synthetic peptide located within the following region: RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 34 kDa
Gene Name protein activator of interferon induced protein kinase EIF2AK2
Background PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA).
Synonyms DYT16; HSD14; PACT; RAX
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...