KHSRP Rabbit Polyclonal Antibody
CAT#: TA345846
Rabbit Polyclonal Anti-KHSRP Antibody
Need it in bulk or conjugated?
Get a free quote
CN¥ 5,250.00
CN¥ 4,840.00
CN¥ 2,900.00
CN¥ 6,650.00
CN¥ 9,998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-KHSRP antibody is: synthetic peptide directed towards the middle region of Human KHSRP. Synthetic peptide located within the following region: WEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 73 kDa |
Gene Name | KH-type splicing regulatory protein |
Database Link | |
Background | KHSRP binds to the dendritic targeting element and may play a role in mRNA trafficking. It is part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. KHSRP mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. It may interact with single-stranded DNA from the far-upstream element (FUSE).It is also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3' UTR, possibly by recruiting degradation machinery to ARE-containing mRNAs. |
Synonyms | FBP2; FUBP2; KSRP |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rabbit: 93% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |