RNase H1 (RNASEH1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RNASEH1 antibody: synthetic peptide directed towards the middle region of human RNASEH1. Synthetic peptide located within the following region: EVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	ribonuclease H1
Database Link	NP_002927 Entrez Gene 246243 Human UniProt ID O60930
Background	RNASEH1 belongs to the RNase H family. It contains 1 RNase H domain. RNASEH1 is an endonuclease that specifically degrades the RNA of RNA-DNA hybrids.
Synonyms	H1RNA; RNH1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 92%
Reference Data
Protein Pathways	DNA replication

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.