RNF113B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RNF113B antibody: synthetic peptide directed towards the C terminal of human RNF113B. Synthetic peptide located within the following region: HYFCESCALEHFRATPRCYICDQPTGGIFNPAKELMAKLQKLQAAEGKKR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	ring finger protein 113B
Database Link	NP_849192 Entrez Gene 140432 Human UniProt ID Q8IZP6
Background	RNF113B contains 1 RING-type zinc finger and 1 C3H1-type zinc finger and the function remains unknown.
Synonyms	bA10G5.1; RNF161; ZNF183L1
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.