KLF17 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KLF17 antibody: synthetic peptide directed towards the N terminal of human KLF17. Synthetic peptide located within the following region: YGRPQAEMEQEAGELSRWQAAHQAAQDNENSAPILNMSSSSGSSGVHTSW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	Kruppel-like factor 17
Database Link	NP_775755 Entrez Gene 128209 Human UniProt ID Q5JT82
Background	KLF17 binds G/C-rich sites via its zinc fingers and activates transcription from CACCC-box elements. It may be a germ cell-specific transcription factor that plays important roles in spermatid differentiation and oocyte development.
Synonyms	Zfp393; ZNF393
Note	Immunogen Sequence Homology: Human: 100%; Rat: 82%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.