ZNF597 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF597 antibody: synthetic peptide directed towards the N terminal of human ZNF597. Synthetic peptide located within the following region: EDAALMGEEGKPEINQQLSLESMELDELALEKYPIAAPLVPYPEKSSEDG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	zinc finger protein 597
Database Link	NP_689670 Entrez Gene 146434 Human UniProt ID Q96LX8
Background	ZNF597 contains 1 KRAB domain and 7 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Synonyms	HIT-4
Note	Immunogen Sequence Homology: Human: 100%; Horse: 90%; Rabbit: 85%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.