INSM2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-INSM2 antibody: synthetic peptide directed towards the N terminal of human INSM2. Synthetic peptide located within the following region: KRTGGLYRVRLAERVFPLLGPQGAPPFLEEAPSASLPGAERATPPTREEP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	INSM transcriptional repressor 2
Database Link	NP_115983 Entrez Gene 84684 Human UniProt ID Q96T92
Background	The function of INSM2 remains unknown.
Synonyms	IA-6; IA6; mlt1
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.