PRDM13 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PRDM13 antibody: synthetic peptide directed towards the C terminal of human PRDM13. Synthetic peptide located within the following region: SLLAKAGDGPGAEPGYPPEPGDPKSDDSDVDVCFTDDQSDPEVGGGGERD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	75 kDa
Gene Name	PR domain 13
Database Link	NP_067633 Entrez Gene 59336 Human UniProt ID Q9H4Q3
Background	PRDM13 may be involved in transcriptional regulation.
Synonyms	MU-MB-20.220; PFM10
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Rat: 92%; Mouse: 92%; Dog: 87%; Pig: 87%; Bovine: 87%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.