ZFP28 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZFP28 antibody: synthetic peptide directed towards the middle region of human ZFP28. Synthetic peptide located within the following region: RKTFIQIGHLNQHKRVHTGERSYNYKKSRKVFRQTAHLAHHQRIHTGESS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	99 kDa
Gene Name	ZFP28 zinc finger protein
Database Link	NP_065879 Entrez Gene 140612 Human UniProt ID Q8NHY6
Background	ZFP28 may be involved in transcriptional regulation. ZFP28 may also have a role in embryonic development.
Synonyms	mkr5
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Guinea pig: 92%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.