ZNF446 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF446 antibody: synthetic peptide directed towards the N terminal of human ZNF446. Synthetic peptide located within the following region: MPSPLGPPCLPVMDPETTLEEPETARLRFRGFCYQEVAGPREALARLREL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	zinc finger protein 446
Database Link	NP_060378 Entrez Gene 55663 Human UniProt ID Q9NWS9
Background	ZNF446 contains a KRAB and three C(2)H(2) zinc fingers. ZNF446 is a transcription repressor when fused to GAL4 DNA-binding domain and co-transfected with VP-16. Overexpression of ZNF446 in COS-7 cells inhibits the transcriptional activities of SRE and AP-
Synonyms	ZKSCAN20; ZSCAN30; ZSCAN52
Note	Immunogen Sequence Homology: Human: 100%; Rat: 90%; Mouse: 90%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.