PHKG1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Phkg1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: REATLKEVDILQKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	phosphorylase kinase catalytic subunit gamma 1
Database Link	NP_006204 Entrez Gene 29353 RatEntrez Gene 5260 Human UniProt ID Q16816
Background	catalytic subunit of phosphorylase kinase complex; plays a role in glycogen metabolism [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: X07320.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS369727, SRS369733 [ECO:0000348] ##Evidence-Data-END##
Synonyms	PHKG
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 86%; Zebrafish: 77%; Goat: 75%
Reference Data
Protein Families	Druggable Genome, Protein Kinase
Protein Pathways	Calcium signaling pathway, Insulin signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.