RRAS Rabbit Polyclonal Antibody

CAT#: TA345135

Rabbit Polyclonal Anti-RRAS Antibody - C-terminal region



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of related RAS viral (r-ras) oncogene homolog (RRAS)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human related RAS viral (r-ras) oncogene homolog (RRAS), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human related RAS viral (r-ras) oncogene homolog (RRAS), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Rat
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-Rras antibody is: synthetic peptide directed towards the C-terminal region of Rat Rras. Synthetic peptide located within the following region: ASSFSASHHMTYFEASAKLRLNVDEAFEQLVRTVRKYQEQELPPSPPSAP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 23 kDa
Gene Name related RAS viral (r-ras) oncogene homolog
Background Regulates the organization of the actin cytoskeleton.
Synonyms Oncogene RRAS; related RAS viral (r-ras) oncogene homolog
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome
Protein Pathways MAPK signaling pathway, Regulation of actin cytoskeleton, Tight junction
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...