CUTC Rabbit Polyclonal Antibody

CAT#: TA345086

Rabbit Polyclonal Anti-CUTC Antibody - middle region



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of cutC copper transporter homolog (E. coli) (CUTC)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human cutC copper transporter homolog (E. coli) (CUTC), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human cutC copper transporter homolog (E. coli) (CUTC), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CUTC antibody: synthetic peptide directed towards the middle region of human CUTC. Synthetic peptide located within the following region: LEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARST
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 29 kDa
Gene Name cutC copper transporter
Background Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper (Gupta et al., 1995 [PubMed 7635807]; Li et al., 2005 [PubMed 16182249]). [supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combination :: BC028948.1, AF132966.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END##
Synonyms CGI-32
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...