C11orf73 (HIKESHI) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-l7Rn6 antibody is: synthetic peptide directed towards the N-terminal region of Rat l7Rn6. Synthetic peptide located within the following region: GKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	17 kDa
Gene Name	chromosome 11 open reading frame 73
Database Link	NP_057485 Entrez Gene 293103 Rat UniProt ID Q53FT3
Background	l7Rn6 acts as a specific nuclear import carrier for HSP70 proteins following heat-shock stress: acts by mediating the nucleoporin-dependent translocation of ATP-bound HSP70 proteins into the nucleus. HSP70 proteins import is required to protect cells from heat shock damages. It does not translocate ADP-bound HSP70 proteins into the nucleus.
Synonyms	C11orf73; HLD13; HSPC138; HSPC179; L7RN6; OPI10
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.