OGDHL Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-OGDHL antibody: synthetic peptide directed towards the N terminal of human OGDHL. Synthetic peptide located within the following region: VFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSWDSFFR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	114 kDa
Gene Name	oxoglutarate dehydrogenase-like
Database Link	NP_060715 Entrez Gene 55753 Human UniProt ID Q9ULD0
Background	The function of OGDHL remains unknown.
Synonyms	FLJ10851
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Horse: 92%; Rat: 85%; Bovine: 85%
Reference Data
Protein Pathways	Citrate cycle (TCA cycle), Lysine degradation, Metabolic pathways, Tryptophan metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.