TDP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Tdp1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Tdp1. Synthetic peptide located within the following region: GRPPGKSAVPLHLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQRWLHSY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	66 kDa
Gene Name	tyrosyl-DNA phosphodiesterase 1
Database Link	NP_060789 Entrez Gene 104884 Mouse UniProt ID Q9NUW8
Background	Tdp1 is a DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 3'-phosphodiester bond, giving rise to DNA with a free 3' phosphate. It catalyzes the hydrolysis of dead-end complexes between DNA and the topoisomerase I active site tyrosine residue and Hydrolyzes 3'-phosphoglycolates on protruding 3' ends on DNA double-strand breaks due to DNA damage by radiation and free radicals. Tdp1 acts on blunt-ended double-strand DNA breaks and on single-stranded DNA. It Has low h3'exonuclease activity and can remove a single nucleoside from the 3'end of DNA and RNA molecules with 3'hydroxyl groups and has no exonuclease activity towards DNA or RNA with a 3'phosphate.
Synonyms	FLJ11090; MGC104252
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.