FEM 1C (FEM1C) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Fem1c antibody is: synthetic peptide directed towards the C-terminal region of Rat Fem1c. Synthetic peptide located within the following region: LHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIYYKGNIPEK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	fem-1 homolog C
Database Link	NP_064562 Entrez Gene 302288 Rat UniProt ID Q96JP0
Background	The function of this protein remains unknown.
Synonyms	EUROIMAGE686608; EUROIMAGE783647; FEM1A
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.