NT5M Rabbit Polyclonal Antibody

CAT#: TA344802

Rabbit Polyclonal Anti-NT5M Antibody - middle region



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of 5',3'-nucleotidase, mitochondrial (NT5M), nuclear gene encoding mitochondrial protein
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human 5',3'-nucleotidase, mitochondrial (NT5M), nuclear gene encoding mitochondrial protein, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human 5',3'-nucleotidase, mitochondrial (NT5M), nuclear gene encoding mitochondrial protein, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-NT5M antibody: synthetic peptide directed towards the middle region of human NT5M. Synthetic peptide located within the following region: KYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 23 kDa
Gene Name 5',3'-nucleotidase, mitochondrial
Background This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromoso
Synonyms dNT-2; dNT2; mdN
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 80%
Reference Data
Protein Pathways Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...