NDUFV2 Rabbit Polyclonal Antibody
CAT#: TA344742
Rabbit Polyclonal Anti-NDUFV2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Ndufv2 antibody is: synthetic peptide directed towards the N-terminal region of Ndufv2. Synthetic peptide located within the following region: GAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHQAAAVLPV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 27 kDa |
Gene Name | NADH:ubiquinone oxidoreductase core subunit V2 |
Database Link | |
Background | Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. |
Synonyms | CI-24k |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 93% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |