TRIB3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TRIB3 antibody: synthetic peptide directed towards the N terminal of human TRIB3. Synthetic peptide located within the following region: YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	tribbles pseudokinase 3
Database Link	NP_066981 Entrez Gene 57761 Human UniProt ID Q96RU7
Background	The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1.
Synonyms	C20orf97; NIPK; SINK; SKIP3; TRB3
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%; Rat: 79%; Sheep: 79%; Bovine: 79%
Reference Data
Protein Families	Druggable Genome, Protein Kinase, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.