DNAJC12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Dnajc12 antibody is synthetic peptide directed towards the middle region of Mouse Dnajc12. Synthetic peptide located within the following region: LAEFKIRALECHPDKHPENSKAVETFQKLQKAKEILCNAESRARYDHWRR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	DnaJ heat shock protein family (Hsp40) member C12
Database Link	NP_068572 Entrez Gene 30045 Mouse UniProt ID Q9UKB3
Background	The function of this protein remains unknown.
Synonyms	JDP1
Note	Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Zebrafish: 85%; Goat: 82%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.