PRSS22 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PRSS22 antibody: synthetic peptide directed towards the N terminal of human PRSS22. Synthetic peptide located within the following region: IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	protease, serine 22
Database Link	NP_071402 Entrez Gene 64063 Human UniProt ID Q9GZN4
Background	This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16.
Synonyms	BSSP-4; hBSSP-4; SP001LA
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Bovine: 91%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.