Ancient ubiquitous protein 1 (AUP1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Aup1 antibody is synthetic peptide directed towards the N-terminal region of Mouse Aup1. Synthetic peptide located within the following region: MPKDSAFPGAPAALRRWRRQRPRSPEAAAMEPPPAPGPERLFDSHRLPSD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	ancient ubiquitous protein 1
Database Link	NP_853553 Entrez Gene 11993 Mouse UniProt ID Q9Y679
Background	The function of this protein remains unknown.
Synonyms	ancient ubiquitous protein 1
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Bovine: 93%; Pig: 87%; Guinea pig: 87%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Dog: 81%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.