SNAPC5 Rabbit Polyclonal Antibody
CAT#: TA344536
Rabbit Polyclonal Anti-SNAPC5 Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SNAPC5 antibody: synthetic peptide directed towards the N terminal of human SNAPC5. Synthetic peptide located within the following region: KEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 11 kDa |
Gene Name | small nuclear RNA activating complex polypeptide 5 |
Database Link | |
Background | SNAPC5 is the part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. SNAPC5 binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box. |
Synonyms | SNAP19 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |