KLF15 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Klf15 antibody is: synthetic peptide directed towards the N-terminal region of Klf15. Synthetic peptide located within the following region: MVDHLLPVDETFSSPKCSVGYLGDRLASRQPYHMLPSPISEDDSDVSSPC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	Kruppel-like factor 15
Database Link	NP_054798 Entrez Gene 66277 Mouse UniProt ID Q9UIH9
Background	The function of this protein remains unknown.
Synonyms	KKLF
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Guinea pig: 93%; Bovine: 92%; Horse: 91%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.