SCP1 (SYCP1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SYCP1 antibody: synthetic peptide directed towards the N terminal of human SYCP1. Synthetic peptide located within the following region: NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	107 kDa
Gene Name	synaptonemal complex protein 1
Database Link	NP_003167 Entrez Gene 6847 Human UniProt ID Q15431
Background	SYCP1 is a major component of the transverse filaments of synaptonemal complexes (SCS), which is formed between homologous chromosomes during meiotic prophase.
Synonyms	CT8; HOM-TES-14; SCP-1; SCP1
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 86%; Rat: 79%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.