SCP1 (SYCP1) Rabbit Polyclonal Antibody
CAT#: TA344377
Rabbit Polyclonal Anti-SYCP1 Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SYCP1 antibody: synthetic peptide directed towards the N terminal of human SYCP1. Synthetic peptide located within the following region: NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 107 kDa |
Gene Name | synaptonemal complex protein 1 |
Database Link | |
Background | SYCP1 is a major component of the transverse filaments of synaptonemal complexes (SCS), which is formed between homologous chromosomes during meiotic prophase. |
Synonyms | CT8; HOM-TES-14; SCP-1; SCP1 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 86%; Rat: 79%; Mouse: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |