SNAP47 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C1orf142 antibody: synthetic peptide directed towards the middle region of human C1orf142. Synthetic peptide located within the following region: TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	synaptosome associated protein 47kDa
Database Link	NP_444280 Entrez Gene 116841 Human UniProt ID Q5SQN1
Background	The function of this protein remains unknown.
Synonyms	C1orf142; ESFI5812; HEL-S-290; HEL170; SNAP-47; SVAP1
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%; Zebrafish: 92%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Rat: 79%; Mouse: 79%; Yeast: 75%
Reference Data
Protein Pathways	SNARE interactions in vesicular transport

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.