CAPS Rabbit Polyclonal Antibody

CAT#: TA344344

Rabbit Polyclonal Anti-CAPS Antibody - N-terminal region



Need it in bulk or conjugated?
Get a free quote

CN¥ 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human calcyphosine (CAPS), transcript variant 1, 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Transient overexpression lysate of calcyphosine (CAPS), transcript variant 2
    • 100 ug

CN¥ 3,080.00


Recombinant protein of human calcyphosine (CAPS), transcript variant 1, 100 µg
    • 100 ug

CN¥ 9,998.00


Transient overexpression lysate of calcyphosine (CAPS), transcript variant 1
    • 100 ug

CN¥ 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CAPS antibody: synthetic peptide directed towards the N terminal of human CAPS. Synthetic peptide located within the following region: DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 21 kDa
Gene Name calcyphosine
Background CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants.
Synonyms CAPS1
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Rabbit: 92%; Horse: 85%; Pig: 77%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...