CAPS Rabbit Polyclonal Antibody
CAT#: TA344344
Rabbit Polyclonal Anti-CAPS Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CN¥ 5,250.00
CN¥ 2,900.00
CN¥ 6,650.00
CN¥ 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CAPS antibody: synthetic peptide directed towards the N terminal of human CAPS. Synthetic peptide located within the following region: DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 21 kDa |
Gene Name | calcyphosine |
Database Link | |
Background | CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants. |
Synonyms | CAPS1 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Rabbit: 92%; Horse: 85%; Pig: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |