Alpha Fodrin (SPTAN1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, IP, WB
Recommend Dilution	WB, IHC, IP
Reactivity	Human, Rat, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SPTAN1 antibody: synthetic peptide directed towards the N terminal of human SPTAN1. Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	272 kDa
Gene Name	spectrin alpha, non-erythrocytic 1
Database Link	NP_003118 Entrez Gene 20740 MouseEntrez Gene 64159 RatEntrez Gene 6709 Human UniProt ID Q13813
Background	Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.
Synonyms	EIEE5; NEAS; SPTA2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Tight junction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.