TRPC6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the N terminal of human TRPC6. Synthetic peptide located within the following region: MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	106 kDa
Gene Name	transient receptor potential cation channel subfamily C member 6
Database Link	NP_004612 Entrez Gene 7225 Human UniProt ID Q9Y210
Background	TRPC6 forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2).
Synonyms	FSGS2; TRP6
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.