Tumor protein D52 like 3 (TPD52L3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TPD52L3 antibody: synthetic peptide directed towards the middle region of human TPD52L3. Synthetic peptide located within the following region: GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	15 kDa
Gene Name	tumor protein D52-like 3
Database Link	NP_001001874 Entrez Gene 89882 Human UniProt ID Q96J77
Background	The exact functions of TPD52L3 remain unknown.
Synonyms	hD55; NYDSP25
Note	Immunogen Sequence Homology: Human: 93%; Dog: 79%; Horse: 79%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.