GIPC3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GIPC3 antibody: synthetic peptide directed towards the middle region of human GIPC3. Synthetic peptide located within the following region: TLRLRSGGAATVEEAPSEFEEEASRKVDDLLESYMGIRDPELASTMVETS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	GIPC PDZ domain containing family member 3
Database Link	NP_573568 Entrez Gene 126326 Human UniProt ID Q8TF64
Background	The function of GIPC3 remains unknown.
Synonyms	C19orf64; DFNB15; DFNB72; DFNB95
Note	Immunogen Sequence Homology: Human: 100%; Dog: 92%; Rat: 90%; Pig: 85%; Guinea pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.