GIPC (GIPC2) Rabbit Polyclonal Antibody
CAT#: TA344075
Rabbit Polyclonal Anti-GIPC2 Antibody
Need it in bulk or conjugated?
Get a free quote
CN¥ 5,250.00
CN¥ 3,080.00
CN¥ 2,900.00
CN¥ 6,650.00
CN¥ 9,998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GIPC2 antibody: synthetic peptide directed towards the N terminal of human GIPC2. Synthetic peptide located within the following region: MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 35 kDa |
Gene Name | GIPC PDZ domain containing family member 2 |
Database Link | |
Background | GIPC1/GIPC, GIPC2, and GIPC3 are a family of central PDZ-domain proteins. GIPC2 might play important roles in human gastric cancer through modulation of growth factor signaling or cell adhesion. GIPC1, GIPC2 and GIPC3 might play key roles in carcinogenesis and embryogenesis through modulation of growth factor signaling and cell adhesion. |
Synonyms | SEMCAP-2; SEMCAP2 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |