splicing factor 1 (SF1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SF1 antibody: synthetic peptide directed towards the C terminal of human SF1. Synthetic peptide located within the following region: APPPPPPPPPGSAGMMIPPRGGDGPSHESEDFPRPLVTLPGRQPQQRPWW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	69 kDa
Gene Name	splicing factor 1
Database Link	NP_973724 Entrez Gene 7536 Human UniProt ID Q15637
Background	SF1 contains 1 CCHC-type zinc finger and 1 KH domain. SF1 is Necessary for the ATP-dependent first step of spliceosome assembly. It binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. SF1 may act as transcription repressor.This gene encodes a member of the heat shock factor (HSF) family of transcriptional activators for heat shock proteins. This gene is a candidate gene for azoospermia, since it localizes to a region of chromosome Y that is sometimes deleted in infertile males. The genome has two identical copies of this gene within a palindromic region; this record represents the more centromeric copy. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Synonyms	BBP; D11S636; MBBP; ZCCHC25; ZFM1; ZNF162
Note	Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Mouse: 93%; Guinea pig: 93%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.